SCOPe 2.08: Domain d5vbqb1: 5vbq B:29-136

Lineage for d5vbqb1 (5vbq B:29-136)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5vbqb1: 5vbq B:29-136 [347933]
   Other proteins in same PDB: d5vbqa2, d5vbqb2
   automated match to d2nxba_
   complexed with cl, edo, r78

Details for d5vbqb1

PDB Entry: 5vbq, 1.65 Å

PDB Description: crystal structure of the first bromodomain of human brdt in complex with bi2536

PDB Compounds: (B:) Bromodomain testis-specific protein

SCOPe Domain Sequences for d5vbqb1:

Sequence; same for both SEQRES and ATOM records:

>d5vbqb1 a.29.2.0 (B:29-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe

Timeline for d5vbqb1:

• d5vbqb1 first appeared in SCOPe 2.07