Lineage for d1lpab2 (1lpa B:1-336)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1616975Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins)
    automatically mapped to Pfam PF00151
  6. 1616976Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
    contains additional, colipase-binding domain
  7. 1616984Species Human (Homo sapiens) [TaxId:9606] [53581] (3 PDB entries)
  8. 1616986Domain d1lpab2: 1lpa B:1-336 [34792]
    Other proteins in same PDB: d1lpaa1, d1lpaa2, d1lpab1
    complexed with bng, ca, plc

Details for d1lpab2

PDB Entry: 1lpa (more details), 3.04 Å

PDB Description: interfacial activation of the lipase-procolipase complex by mixed micelles revealed by x-ray crystallography
PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1lpab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpab2 c.69.1.19 (B:1-336) Pancreatic lipase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
psggcpqmghyadrypgktndvgqkfyldtgdasnfa

SCOPe Domain Coordinates for d1lpab2:

Click to download the PDB-style file with coordinates for d1lpab2.
(The format of our PDB-style files is described here.)

Timeline for d1lpab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lpab1