SCOPe 2.05: Domain d1lpbb2: 1lpb B:1-336

Lineage for d1lpbb2 (1lpb B:1-336)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins)
   automatically mapped to Pfam PF00151

6. Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
   contains additional, colipase-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [53581] (3 PDB entries)

8. Domain d1lpbb2: 1lpb B:1-336 [34791]
   Other proteins in same PDB: d1lpba1, d1lpba2, d1lpbb1
   complexed with bog, ca, mup

Details for d1lpbb2

PDB Entry: 1lpb, 2.46 Å

PDB Description: the 2.46 angstroms resolution structure of the pancreatic lipase colipase complex inhibited by a c11 alkyl phosphonate

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1lpbb2:

Sequence; same for both SEQRES and ATOM records:

>d1lpbb2 c.69.1.19 (B:1-336) Pancreatic lipase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
psggcpqmghyadrypgktndvgqkfyldtgdasnfa

Timeline for d1lpbb2:

• d1lpbb2 first appeared (with stable ids) in SCOP 1.55
  
• d1lpbb2 appears in SCOPe 2.04
  
• d1lpbb2 appears in SCOPe 2.06
  
• d1lpbb2 appears in the current release, SCOPe 2.08