Lineage for d5uhta1 (5uht A:244-320)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318503Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2318543Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2318561Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 2318562Protein automated matches [227713] (2 species)
    not a true protein
  7. 2318566Species Thermotoga maritima [TaxId:243274] [227714] (5 PDB entries)
  8. 3047847Domain d5uhta1: 5uht A:244-320 [347909]
    Other proteins in same PDB: d5uhta2, d5uhtb_, d5uhtc2, d5uhtd_
    automated match to d2c2aa1
    complexed with adp, gol, mg, so4

Details for d5uhta1

PDB Entry: 5uht (more details), 2.68 Å

PDB Description: structure of the thermotoga maritima hk853-bef3-rr468 complex at ph 5.0
PDB Compounds: (A:) sensor histidine kinase

SCOPe Domain Sequences for d5uhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uhta1 a.30.2.0 (A:244-320) automated matches {Thermotoga maritima [TaxId: 243274]}
lkridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhle
nllnelldfsrlerksl

SCOPe Domain Coordinates for d5uhta1:

Click to download the PDB-style file with coordinates for d5uhta1.
(The format of our PDB-style files is described here.)

Timeline for d5uhta1:

  • d5uhta1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06