| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins) automatically mapped to Pfam PF00151 |
| Protein Pancreatic lipase, N-terminal domain [53578] (6 species) contains additional, colipase-binding domain |
| Species Pig (Sus scrofa) [TaxId:9823] [53580] (1 PDB entry) |
| Domain d1ethc2: 1eth C:1-336 [34790] Other proteins in same PDB: d1etha1, d1ethb1, d1ethb2, d1ethc1, d1ethd1, d1ethd2 complexed with bme, c8e, ca |
PDB Entry: 1eth (more details), 2.8 Å
SCOPe Domain Sequences for d1ethc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ethc2 c.69.1.19 (C:1-336) Pancreatic lipase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
psegcpqmghyadrfpgktngvsqvfylntgdasnf
Timeline for d1ethc2: