SCOP 1.55: Domain d1ethc2: 1eth C:1-336

Lineage for d1ethc2 (1eth C:1-336)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families)
Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
Species Pig (Sus scrofa) [TaxId:9823] [53580] (1 PDB entry)
Domain d1ethc2: 1eth C:1-336 [34790]
Other proteins in same PDB: d1etha1, d1ethb1, d1ethb2, d1ethc1, d1ethd1, d1ethd2

Details for d1ethc2

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex

SCOP Domain Sequences for d1ethc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ethc2 c.69.1.19 (C:1-336) Pancreatic lipase, N-terminal domain {Pig (Sus scrofa)}
sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
psegcpqmghyadrfpgktngvsqvfylntgdasnf

SCOP Domain Coordinates for d1ethc2:

Click to download the PDB-style file with coordinates for d1ethc2.
(The format of our PDB-style files is described here.)

Timeline for d1ethc2: