Lineage for d1etha2 (1eth A:1-336)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870314Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 proteins)
    automatically mapped to Pfam PF00151
  6. 1870315Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
    contains additional, colipase-binding domain
  7. 1870329Species Pig (Sus scrofa) [TaxId:9823] [53580] (1 PDB entry)
  8. 1870330Domain d1etha2: 1eth A:1-336 [34789]
    Other proteins in same PDB: d1etha1, d1ethb1, d1ethb2, d1ethc1, d1ethd1, d1ethd2
    complexed with bme, c8e, ca

Details for d1etha2

PDB Entry: 1eth (more details), 2.8 Å

PDB Description: triacylglycerol lipase/colipase complex
PDB Compounds: (A:) triacylglycerol acyl-hydrolase

SCOPe Domain Sequences for d1etha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etha2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
sevcfprlgcfsddapwagivqrplkilpwspkdvdtrfllytnqnqnnyqelvadpsti
tnsnfrmdrktrfiihgfidkgeedwlsnicknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfvevlksslgyspsnvhvighslgshaageagrrtngtieritgldpae
pcfqgtpelvrldpsdakfvdvihtdaapiipnlgfgmsqtvghldffpnggkqmpgcqk
nilsqivdidgiwegtrdfvacnhlrsykyyadsilnpdgfagfpcdsynvftankcfpc
psegcpqmghyadrfpgktngvsqvfylntgdasnf

SCOPe Domain Coordinates for d1etha2:

Click to download the PDB-style file with coordinates for d1etha2.
(The format of our PDB-style files is described here.)

Timeline for d1etha2: