Lineage for d5ui1a_ (5ui1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998251Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 2998252Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries)
    Uniprot P53041 176-499
  8. 2998271Domain d5ui1a_: 5ui1 A: [347878]
    automated match to d1s95a_
    complexed with 8d4, mn

Details for d5ui1a_

PDB Entry: 5ui1 (more details), 1.96 Å

PDB Description: crystal structure of human protein phosphatase 5c (pp5c) in complex with a triazole inhibitor
PDB Compounds: (A:) Serine/threonine-protein phosphatase 5

SCOPe Domain Sequences for d5ui1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ui1a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
gpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlketeki
tvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypdhf
hllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhgglfs
edgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkaflee
nnldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhqft
avphpnvkpmay

SCOPe Domain Coordinates for d5ui1a_:

Click to download the PDB-style file with coordinates for d5ui1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ui1a_: