Lineage for d5uhtc2 (5uht C:321-480)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537568Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2537615Protein automated matches [190839] (4 species)
    not a true protein
  7. 2537630Species Thermotoga maritima [TaxId:243274] [227717] (5 PDB entries)
  8. 3047788Domain d5uhtc2: 5uht C:321-480 [347850]
    Other proteins in same PDB: d5uhta1, d5uhtb_, d5uhtc1, d5uhtd_
    automated match to d2c2aa2
    complexed with adp, gol, mg, so4

Details for d5uhtc2

PDB Entry: 5uht (more details), 2.68 Å

PDB Description: structure of the thermotoga maritima hk853-bef3-rr468 complex at ph 5.0
PDB Compounds: (C:) sensor histidine kinase

SCOPe Domain Sequences for d5uhtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uhtc2 d.122.1.3 (C:321-480) automated matches {Thermotoga maritima [TaxId: 243274]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkdr

SCOPe Domain Coordinates for d5uhtc2:

Click to download the PDB-style file with coordinates for d5uhtc2.
(The format of our PDB-style files is described here.)

Timeline for d5uhtc2:

  • d5uhtc2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06