Lineage for d5v4vb_ (5v4v B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828301Protein automated matches [190228] (20 species)
    not a true protein
  7. 2828302Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347828] (2 PDB entries)
  8. 2828304Domain d5v4vb_: 5v4v B: [347842]
    automated match to d1bwka_
    complexed with fmn, gol, nca

Details for d5v4vb_

PDB Entry: 5v4v (more details), 1.8 Å

PDB Description: saccharomyces cerevisiae old yellow enzyme 3
PDB Compounds: (B:) NADPH dehydrogenase 3

SCOPe Domain Sequences for d5v4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v4vb_ c.1.4.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pfvkgfepislrdtnlfepikigntqlahravmppltrmrathpgnipnkewaavyygqr
aqrpgtmiitegtfispqaggydnapgiwsdeqvaewkniflaihdcqsfawvqlwslgw
asfpdvlardglrydcasdrvymnatlqekakdannlehsltkddikqyikdyihaakns
iaagadgveihsangyllnqfldphsnkrtdeyggtienrarftlevvdalietigperv
glrlspygtfnsmsggaepgiiaqysyvlgelekrakagkrlafvhlveprvtdpslveg
egeysegtndfaysiwkgpiiragnyalhpevvreqvkdprtligygrffisnpdlvyrl
eeglplnkydrstfytmsaegytdyptyeeavdlgwn

SCOPe Domain Coordinates for d5v4vb_:

Click to download the PDB-style file with coordinates for d5v4vb_.
(The format of our PDB-style files is described here.)

Timeline for d5v4vb_: