SCOPe 2.08: Domain d5ucxc1: 5ucx C:1-194

Lineage for d5ucxc1 (5ucx C:1-194)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries)

8. Domain d5ucxc1: 5ucx C:1-194 [347836]
   Other proteins in same PDB: d5ucxa2, d5ucxb2, d5ucxc2, d5ucxd2, d5ucxe2, d5ucxf2, d5ucxg2, d5ucxh2, d5ucxi2
   automated match to d3tkra_

Details for d5ucxc1

PDB Entry: 5ucx, 2.4 Å

PDB Description: structure of s78c human peroxiredoxin 3 as three stacked rings

PDB Compounds: (C:) Thioredoxin-dependent peroxide reductase, mitochondrial

SCOPe Domain Sequences for d5ucxc1:

Sequence; same for both SEQRES and ATOM records:

>d5ucxc1 c.47.1.10 (C:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apavtqhapyfkgtavvngefkdlslddfkgkylvlffypldftfvcpteivafsdkane
fhdvncevvavsvdshfchlawintprkngglghmniallsdltkqisrdygvllegsgl
alrglfiidpngvikhlsvndlpvgrsveetlrlvkafqyvethgevcpanwtpdsptik
pspaaskeyfqkvn

Timeline for d5ucxc1:

• d5ucxc1 first appeared in SCOPe 2.07