SCOPe 2.08: Domain d5uy8a2: 5uy8 A:201-592

Lineage for d5uy8a2 (5uy8 A:201-592)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins)
   duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs

6. Protein automated matches [347771] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [347772] (2 PDB entries)

8. Domain d5uy8a2: 5uy8 A:201-592 [347817]
   Other proteins in same PDB: d5uy8a1, d5uy8b1, d5uy8c1, d5uy8d1
   automated match to d1pkxa2
   complexed with 8um, amz, mg

Details for d5uy8a2

PDB Entry: 5uy8, 2.39 Å

PDB Description: crystal structure of aicarft bound to an antifolate

PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d5uy8a2:

Sequence; same for both SEQRES and ATOM records:

>d5uy8a2 c.97.1.4 (A:201-592) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcdalnawqlvkelkealgip
aaasfkhvspagaavgiplsedeakvcmvydlyktltpisaayarargadrmssfgdfva
lsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnycvlqmdqsykpdenevrt
lfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivatiavkytqsnsvcyakngq
vigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvkraeisnaidqyvtgtig
ededlikwkalfeevpellteaekkewvekltevsissdaffpfrdnvdrakrsgvayia
apsgsaadkvvieacdelgiilahtnlrlfhh

Timeline for d5uy8a2:

• d5uy8a2 first appeared in SCOPe 2.07