Lineage for d5v03b1 (5v03 B:396-487)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577229Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 2577230Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 2577231Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 2577232Protein Small-conductance potassium channel [64528] (2 species)
  7. 3047712Species Homo sapiens [TaxId:9606] [347774] (2 PDB entries)
  8. 3047713Domain d5v03b1: 5v03 B:396-487 [347775]
    Other proteins in same PDB: d5v03b2, d5v03b3, d5v03r_
    automated match to d1kkda_
    complexed with 658, ca, so4

Details for d5v03b1

PDB Entry: 5v03 (more details), 1.58 Å

PDB Description: a positive allosteric modulator binding pocket in sk2 ion channels is shared by riluzole and cyppa
PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d5v03b1:

Sequence, based on SEQRES records: (download)

>d5v03b1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Homo sapiens [TaxId: 9606]}
rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
flqaihqlrsvkmeqrklndqantlvdlaktq

Sequence, based on observed residues (ATOM records): (download)

>d5v03b1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Homo sapiens [TaxId: 9606]}
rkleltkadtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlr
svkmeqrklndqantlvdlaktq

SCOPe Domain Coordinates for d5v03b1:

Click to download the PDB-style file with coordinates for d5v03b1.
(The format of our PDB-style files is described here.)

Timeline for d5v03b1:

  • d5v03b1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from other chains:
(mouse over for more information)
d5v03r_