Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries) |
Domain d5u8ra3: 5u8r A:302-457 [347743] Other proteins in same PDB: d5u8ra2, d5u8ra4, d5u8ra5, d5u8rh_, d5u8rl_ automated match to d2dtge5 complexed with imd, mlt, nag, so4 |
PDB Entry: 5u8r (more details), 3 Å
SCOPe Domain Sequences for d5u8ra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u8ra3 c.10.2.0 (A:302-457) automated matches {Human (Homo sapiens) [TaxId: 9606]} ceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvkir hshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfafn pklcvseiyrmeevtgtkgrqskgdintrnngeras
Timeline for d5u8ra3:
View in 3D Domains from same chain: (mouse over for more information) d5u8ra1, d5u8ra2, d5u8ra4, d5u8ra5 |