Lineage for d5umsa_ (5ums A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394983Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2394984Protein automated matches [190052] (7 species)
    not a true protein
  7. 2395025Species Human (Homo sapiens) [TaxId:9606] [186914] (63 PDB entries)
  8. 3047652Domain d5umsa_: 5ums A: [347714]
    automated match to d4pq0a_

Details for d5umsa_

PDB Entry: 5ums (more details), 1.57 Å

PDB Description: crystal structure of middle double ph domain of human fact complex subunit ssrp1
PDB Compounds: (A:) FACT complex subunit SSRP1

SCOPe Domain Sequences for d5umsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umsa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qatgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrq
mffvisldppikqgqtryhflillfskdedisltlnmneeevekrfegrltknmsgslye
mvsrvmkalvnrkitvpgnfqghsgaqcitcsykassgllyplergfiyvhkppvhirfd
eisfvnfargttttrsfdfeietkqgtqytfssiereeygklfdfvnakklniknrgl

SCOPe Domain Coordinates for d5umsa_:

Click to download the PDB-style file with coordinates for d5umsa_.
(The format of our PDB-style files is described here.)

Timeline for d5umsa_: