Lineage for d5n56b2 (5n56 B:92-199)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2514007Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2514008Protein automated matches [226860] (35 species)
    not a true protein
  7. 3047606Species Staphylococcus aureus [TaxId:273036] [347668] (1 PDB entry)
  8. 3047641Domain d5n56b2: 5n56 B:92-199 [347703]
    Other proteins in same PDB: d5n56a1, d5n56b1
    automated match to d2rcva2
    complexed with mn

Details for d5n56b2

PDB Entry: 5n56 (more details), 2.07 Å

PDB Description: staphylococcus aureus mn-dependent superoxide dismutase soda
PDB Compounds: (B:) Superoxide dismutase [Mn/Fe] 1

SCOPe Domain Sequences for d5n56b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n56b2 d.44.1.0 (B:92-199) automated matches {Staphylococcus aureus [TaxId: 273036]}
seekgtvvekikeqwgsleefkkefadkaaarfgsgwawlvvnngqleivttpnqdnplt
egktpilgldvwehayylkyqnkrpdyigafwnvvnwekvdelynatk

SCOPe Domain Coordinates for d5n56b2:

Click to download the PDB-style file with coordinates for d5n56b2.
(The format of our PDB-style files is described here.)

Timeline for d5n56b2:

  • d5n56b2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5n56b1