SCOPe 2.08: Domain d5t4xa1: 5t4x A:1-150

Lineage for d5t4xa1 (5t4x A:1-150)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [347656] (1 PDB entry)

8. Domain d5t4xa1: 5t4x A:1-150 [347657]
   Other proteins in same PDB: d5t4xa2
   automated match to d5x72a_

Details for d5t4xa1

PDB Entry: 5t4x, 1.81 Å

PDB Description: crystal structure of pde6d in apo-state

PDB Compounds: (A:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5t4xa1:

Sequence, based on SEQRES records:

>d5t4xa1 b.1.18.8 (A:1-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
msakderardilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
relnfssaeqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpa
svltgnviietkffdddllvstskvrlfyv

Sequence, based on observed residues (ATOM records):

>d5t4xa1 b.1.18.8 (A:1-150) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
msakderardilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
relnfssaeqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliemmpasvltgn
viietkffdddllvstskvrlfyv

Timeline for d5t4xa1:

• d5t4xa1 first appeared in SCOPe 2.07