Lineage for d5ulua1 (5ulu A:1934-2038)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763600Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
  8. 2763653Domain d5ulua1: 5ulu A:1934-2038 [347624]
    automated match to d5i8da1
    complexed with ca; mutant

Details for d5ulua1

PDB Entry: 5ulu (more details), 2.85 Å

PDB Description: crystal structure of mouse cadherin-23 ec19-21 (s2087p) with non- syndromic deafness (dfnb12) associated mutation d2148n
PDB Compounds: (A:) cadherin-23

SCOPe Domain Sequences for d5ulua1:

Sequence, based on SEQRES records: (download)

>d5ulua1 b.1.6.0 (A:1934-2038) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
plftegtyqaevmenspagtpltvlngpilaldadedvyavvtyqllgthsdlfvidnst
gvvtvrsgiiidreafsppflellllaedigqlngtahlfitild

Sequence, based on observed residues (ATOM records): (download)

>d5ulua1 b.1.6.0 (A:1934-2038) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
plftegtyqaevmenspagtpltvlngpilalvtyqllgthsdlfvidnstgvvtvrsgi
iidreafsppflellllaedigqlngtahlfitild

SCOPe Domain Coordinates for d5ulua1:

Click to download the PDB-style file with coordinates for d5ulua1.
(The format of our PDB-style files is described here.)

Timeline for d5ulua1: