Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
Protein automated matches [347525] (2 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347526] (2 PDB entries) |
Domain d5oy0l_: 5oy0 L: [347527] Other proteins in same PDB: d5oy01_, d5oy02_, d5oy03_, d5oy04_, d5oy05_, d5oy06_, d5oy07_, d5oy08_, d5oy0a_, d5oy0b_, d5oy0c_, d5oy0d_, d5oy0e_, d5oy0f_, d5oy0h_, d5oy0i_, d5oy0j_, d5oy0k_ automated match to d1jb0l_ complexed with 45d, act, bcr, ca, cl, cla, dgd, ech, eq3, lhg, lmg, lmt, mg, pqn, sf4, sqd, zex |
PDB Entry: 5oy0 (more details), 2.5 Å
SCOPe Domain Sequences for d5oy0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oy0l_ f.31.1.1 (L:) automated matches {Synechocystis sp. [TaxId: 1111708]} maesnqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyf ligpwtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgw sqfaagffvggmggafvayfllenlsvvdgifrglfn
Timeline for d5oy0l_: