SCOPe 2.08: Domain d5nmma2: 5nmm A:507-593

Lineage for d5nmma2 (5nmm A:507-593)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (3 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)

8. Domain d5nmma2: 5nmm A:507-593 [347447]
   automated match to d4o6wa2
   complexed with 8z5

Details for d5nmma2

PDB Entry: 5nmm, 2.02 Å

PDB Description: the structure of the polo-box domain (pbd) of plk1 in complex with alpha-bromo-3-iodotoluene.

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d5nmma2:

Sequence; same for both SEQRES and ATOM records:

>d5nmma2 d.223.1.2 (A:507-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrlsl
leeygcckelasrlryartmvdkllss

Timeline for d5nmma2:

• d5nmma2 first appeared in SCOPe 2.07