Lineage for d5o4ka_ (5o4k A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2330984Protein Cyp121 monooxygenase (P450 Mt2) [81865] (3 species)
  7. 3047034Species Mycobacterium tuberculosis [TaxId:83331] [347096] (5 PDB entries)
  8. 3047350Domain d5o4ka_: 5o4k A: [347412]
    automated match to d1n40a_
    complexed with 9ke, hem, so4

Details for d5o4ka_

PDB Entry: 5o4k (more details), 1.5 Å

PDB Description: crystal structure of p450 cyp121 in complex with compound 6b.
PDB Compounds: (A:) Mycocyclosin synthase

SCOPe Domain Sequences for d5o4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o4ka_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 83331]}
atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
lkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d5o4ka_:

Click to download the PDB-style file with coordinates for d5o4ka_.
(The format of our PDB-style files is described here.)

Timeline for d5o4ka_:

  • d5o4ka_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06