Lineage for d5o49b_ (5o49 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543630Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543631Species Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries)
  8. 3047330Domain d5o49b_: 5o49 B: [347392]
    automated match to d4v04b_
    complexed with 9k5, so4

Details for d5o49b_

PDB Entry: 5o49 (more details), 1.91 Å

PDB Description: human fgf in complex with a covalent inhibitor
PDB Compounds: (B:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d5o49b_:

Sequence, based on SEQRES records: (download)

>d5o49b_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksd
atekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpp
gleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmki
adfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggs
pypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldriva
ltsnqe

Sequence, based on observed residues (ATOM records): (download)

>d5o49b_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldpnrvtkvavkmlksdate
kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgeq
lsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglhidyykkttn
grlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrm
dkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe

SCOPe Domain Coordinates for d5o49b_:

Click to download the PDB-style file with coordinates for d5o49b_.
(The format of our PDB-style files is described here.)

Timeline for d5o49b_: