Lineage for d5od2c_ (5od2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904772Species Methanocaldococcus jannaschii [TaxId:243232] [347364] (1 PDB entry)
  8. 2904775Domain d5od2c_: 5od2 C: [347386]
    automated match to d1u2xa_
    complexed with 5id, glc, mg, po4

Details for d5od2c_

PDB Entry: 5od2 (more details), 1.98 Å

PDB Description: crystal structure of adp-dependent glucokinase from methanocaldococcus jannaschii
PDB Compounds: (C:) Bifunctional ADP-specific glucokinase/phosphofructokinase

SCOPe Domain Sequences for d5od2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5od2c_ c.72.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
eikkfietikgtklftayntnvdaikylkdedvqklvdefnhkdiiermeeypriieepl
dfvarlvhsiktgkpaevpikddkklhewfdrikydeermggqagivsnlmatlqidkii
vytpflskkqaemfvdydnllyplvengnlvlkkvreayrddpikinrifefkkglkfkl
ngeeitakqstrfivasrpealrieikddvrkflpkigeavdcaflsgyqaikeeyrdgk
takyyferaeedikllkknknikthlefasisnieirkmvvdyilsnvesvgmdeteian
vlhilgydelsnnilkdsfiedviegakilldkfknlevvqvhtiyyilfvcradnplsk
eeleeclefstilastkaklgniraiddlheglkiphnkygdllkeiaekfndnnykial
spsryvekpkstvglgdtissgafvyyvsllnkkrm

SCOPe Domain Coordinates for d5od2c_:

Click to download the PDB-style file with coordinates for d5od2c_.
(The format of our PDB-style files is described here.)

Timeline for d5od2c_: