Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [347364] (1 PDB entry) |
Domain d5od2c_: 5od2 C: [347386] automated match to d1u2xa_ complexed with 5id, glc, mg, po4 |
PDB Entry: 5od2 (more details), 1.98 Å
SCOPe Domain Sequences for d5od2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5od2c_ c.72.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} eikkfietikgtklftayntnvdaikylkdedvqklvdefnhkdiiermeeypriieepl dfvarlvhsiktgkpaevpikddkklhewfdrikydeermggqagivsnlmatlqidkii vytpflskkqaemfvdydnllyplvengnlvlkkvreayrddpikinrifefkkglkfkl ngeeitakqstrfivasrpealrieikddvrkflpkigeavdcaflsgyqaikeeyrdgk takyyferaeedikllkknknikthlefasisnieirkmvvdyilsnvesvgmdeteian vlhilgydelsnnilkdsfiedviegakilldkfknlevvqvhtiyyilfvcradnplsk eeleeclefstilastkaklgniraiddlheglkiphnkygdllkeiaekfndnnykial spsryvekpkstvglgdtissgafvyyvsllnkkrm
Timeline for d5od2c_: