Lineage for d5or7a_ (5or7 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410774Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2410775Protein automated matches [190988] (15 species)
    not a true protein
  7. 3047205Species Murine norovirus gv/cr10/2005/usa [TaxId:463724] [347267] (1 PDB entry)
  8. 3047206Domain d5or7a_: 5or7 A: [347268]
    Other proteins in same PDB: d5or7c_
    automated match to d1ihmb_
    complexed with na

Details for d5or7a_

PDB Entry: 5or7 (more details), 2.05 Å

PDB Description: atomic structure of the murine norovirus protruding domain and scd300lf receptor complex
PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d5or7a_:

Sequence, based on SEQRES records: (download)

>d5or7a_ b.121.4.0 (A:) automated matches {Murine norovirus gv/cr10/2005/usa [TaxId: 463724]}
rmvdlpvlqprlctharwpapiygllvdpslpsnpqwqngrvhvdgtllgttpvsgswvs
cfaaeaayefqsgtgevatftlieqdgsayvpgdraaplgypdfsgqleievqtettktg
dklkvttfemilgpttnvdqapyqgrvyasltavasldlvdgrvravprsiygfqdvipe
yndgllvplappigpflpgevllrfrtymrqldtadaaaeaidcalpqefiswfasnaft
vqsdalllryrntltgqllfecklysegyialsysgsgpltfptdgffevvswvprlfql
asv

Sequence, based on observed residues (ATOM records): (download)

>d5or7a_ b.121.4.0 (A:) automated matches {Murine norovirus gv/cr10/2005/usa [TaxId: 463724]}
rmvdlpvlqprlctharwpapiygllvdpslpsnpqwqngrvhvdgtllgttpvsgswvs
cfaaeaayefqsgtgevatftlieqdgsayvpgdraaplgypdfsgqleievqtettkkl
kvttfemilgpttnvdqapyqgrvyasltavasldlvdgrvravprsiygfqdvipeynd
gllvplappigpflpgevllrfrtymrqldaaaeaidcalpqefiswfasnaftvqsdal
llryrntltgqllfecklysegyialsysgsgpltfptdgffevvswvprlfqlasv

SCOPe Domain Coordinates for d5or7a_:

Click to download the PDB-style file with coordinates for d5or7a_.
(The format of our PDB-style files is described here.)

Timeline for d5or7a_:

  • d5or7a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-06