Lineage for d5okdd2 (5okd D:196-240)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631158Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 2631203Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 2631204Protein automated matches [232791] (3 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [254894] (2 PDB entries)
  8. 2631228Domain d5okdd2: 5okd D:196-240 [347264]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
    automated match to d2a06d2
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdd2

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d5okdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdd2 f.23.11.0 (D:196-240) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp

SCOPe Domain Coordinates for d5okdd2:

Click to download the PDB-style file with coordinates for d5okdd2.
(The format of our PDB-style files is described here.)

Timeline for d5okdd2: