SCOPe 2.07: Domain d5okdd2: 5okd D:196-240

Lineage for d5okdd2 (5okd D:196-240)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254894] (2 PDB entries)

8. Domain d5okdd2: 5okd D:196-240 [347264]
   Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
   automated match to d2a06d2
   complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdd2

PDB Entry: 5okd, 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d5okdd2:

Sequence; same for both SEQRES and ATOM records:

>d5okdd2 f.23.11.0 (D:196-240) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp

Timeline for d5okdd2:

• d5okdd2 is new in SCOPe 2.07-stable
  
• d5okdd2 appears in the current release, SCOPe 2.08