Lineage for d5nuea2 (5nue A:157-332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 3046901Species Arabidopsis thaliana [TaxId:3702] [346963] (2 PDB entries)
  8. 3047190Domain d5nuea2: 5nue A:157-332 [347252]
    Other proteins in same PDB: d5nuea1, d5nueb1, d5nuec1
    automated match to d5mdha2
    complexed with act, edo, etx, fmt, gol, nad, peo, so4, trs

Details for d5nuea2

PDB Entry: 5nue (more details), 1.35 Å

PDB Description: cytosolic malate dehydrogenase 1 (peroxide-treated)
PDB Compounds: (A:) Malate dehydrogenase 1, cytoplasmic

SCOPe Domain Sequences for d5nuea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nuea2 d.162.1.0 (A:157-332) automated matches {Arabidopsis thaliana [TaxId: 3702]}
trldhnralgqiserlsvpvsdvknviiwgnhsssqypdvnhakvqtssgekpvrelvkd
dawldgefistvqqrgaaiikarklssalsaassacdhirdwvlgtpegtfvsmgvysdg
sysvpsgliysfpvtcrngdwsivqglpidevsrkkmdltaeelkeekdlayscls

SCOPe Domain Coordinates for d5nuea2:

Click to download the PDB-style file with coordinates for d5nuea2.
(The format of our PDB-style files is described here.)

Timeline for d5nuea2:

  • d5nuea2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06