Lineage for d5nufb1 (5nuf B:4-156)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 2432468Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255800] (3 PDB entries)
  8. 3047128Domain d5nufb1: 5nuf B:4-156 [347190]
    Other proteins in same PDB: d5nufa2, d5nufb2, d5nufc2
    automated match to d5mdha1
    complexed with act, edo, fmt, gol, na, nad, peg, peo, so4

Details for d5nufb1

PDB Entry: 5nuf (more details), 1.8 Å

PDB Description: cytosolic malate dehydrogenase 1
PDB Compounds: (B:) Malate dehydrogenase 1, cytoplasmic

SCOPe Domain Sequences for d5nufb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nufb1 c.2.1.0 (B:4-156) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
epvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelidaaf
pllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekhaap
nckvlvvanpantnalilkefapsipekniscl

SCOPe Domain Coordinates for d5nufb1:

Click to download the PDB-style file with coordinates for d5nufb1.
(The format of our PDB-style files is described here.)

Timeline for d5nufb1:

  • d5nufb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06