Lineage for d5o3ud2 (5o3u D:439-724)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903291Species Vaccaria hispanica [TaxId:39387] [347033] (4 PDB entries)
  8. 2903295Domain d5o3ud2: 5o3u D:439-724 [347159]
    Other proteins in same PDB: d5o3ua1, d5o3ub1, d5o3uc1, d5o3ud1
    automated match to d1e8na2

Details for d5o3ud2

PDB Entry: 5o3u (more details), 1.86 Å

PDB Description: structural characterization of the fast and promiscuous macrocyclase from plant - pcy1-s562a bound to presegetalin f1
PDB Compounds: (D:) Peptide cyclase 1

SCOPe Domain Sequences for d5o3ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o3ud2 c.69.1.0 (D:439-724) automated matches {Vaccaria hispanica [TaxId: 39387]}
drsefevkqvfvpskdgtkipifiaarkgisldgshpcemhgyggfginmmptfsasriv
flkhlggvfclanirgggeygeewhkagfrdkkqnvfddfisaaeylissgytkarrvai
egganggllvaacinqrpdlfgcaeancgvmdmlrfhkftlgylwtgdygcsdkeeefkw
likyspihnvrrpweqpgneetqypatmiltadhddrvvplhsfkllatmqhvlctsled
spqknpiiariqrkaahygratmtqiaevadrygfmakaleapwid

SCOPe Domain Coordinates for d5o3ud2:

Click to download the PDB-style file with coordinates for d5o3ud2.
(The format of our PDB-style files is described here.)

Timeline for d5o3ud2: