Lineage for d5nyva_ (5nyv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903006Species Rhodopseudomonas palustris [TaxId:74570] [347051] (1 PDB entry)
  8. 2903007Domain d5nyva_: 5nyv A: [347146]
    automated match to d5k3ba_

Details for d5nyva_

PDB Entry: 5nyv (more details), 1.6 Å

PDB Description: crystal structure determination from picosecond infrared laser ablated protein crystals by serial synchrotron crystallography
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5nyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nyva_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 74570]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs

SCOPe Domain Coordinates for d5nyva_:

Click to download the PDB-style file with coordinates for d5nyva_.
(The format of our PDB-style files is described here.)

Timeline for d5nyva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nyvb_