Lineage for d5oi2a_ (5oi2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886283Protein automated matches [190209] (5 species)
    not a true protein
  7. 2886284Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)
  8. 2886409Domain d5oi2a_: 5oi2 A: [347133]
    automated match to d3vq9c_
    complexed with 9vn, mg, so4

Details for d5oi2a_

PDB Entry: 5oi2 (more details), 2.2 Å

PDB Description: dissociation of biochemical and antiretroviral activities of integrase-ledgf allosteric inhibitors revealed by resistance of a125 polymorphic hiv-1
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d5oi2a_:

Sequence, based on SEQRES records: (download)

>d5oi2a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d5oi2a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqmnkelkkiigqvrdqaehlktavqmavfihnkkrkysag
erivdiiatdi

SCOPe Domain Coordinates for d5oi2a_:

Click to download the PDB-style file with coordinates for d5oi2a_.
(The format of our PDB-style files is described here.)

Timeline for d5oi2a_: