Lineage for d5nlza_ (5nlz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780743Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 2780748Domain d5nlza_: 5nlz A: [347109]
    automated match to d5jpgb_

Details for d5nlza_

PDB Entry: 5nlz (more details), 1.15 Å

PDB Description: grifin (crystallisation ph: 4.2)
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d5nlza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nlza_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
ilndieissveitkrgly

SCOPe Domain Coordinates for d5nlza_:

Click to download the PDB-style file with coordinates for d5nlza_.
(The format of our PDB-style files is described here.)

Timeline for d5nlza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nlzb_