Lineage for d5mzmd1 (5mzm D:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938003Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)
  8. 2938037Domain d5mzmd1: 5mzm D:1-181 [347104]
    Other proteins in same PDB: d5mzma2, d5mzmb_, d5mzmd2, d5mzme_
    automated match to d1n5aa2
    complexed with gol, so4

Details for d5mzmd1

PDB Entry: 5mzm (more details), 2.4 Å

PDB Description: structure of h-2db in complex with teipp apl trh4 p3p
PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d5mzmd1:

Sequence, based on SEQRES records: (download)

>d5mzmd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Sequence, based on observed residues (ATOM records): (download)

>d5mzmd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylknglr

SCOPe Domain Coordinates for d5mzmd1:

Click to download the PDB-style file with coordinates for d5mzmd1.
(The format of our PDB-style files is described here.)

Timeline for d5mzmd1: