SCOPe 2.07: Domain d5o7la1: 5o7l A:1-47

Lineage for d5o7la1 (5o7l A:1-47)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (2 proteins)

6. Protein automated matches [190339] (1 species)
   not a true protein

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (12 PDB entries)

8. Domain d5o7la1: 5o7l A:1-47 [347101]
   Other proteins in same PDB: d5o7la2, d5o7lb2
   automated match to d1iv7a_
   complexed with so4; mutant

Details for d5o7la1

PDB Entry: 5o7l, 2.6 Å

PDB Description: crystal structure of a single chain monellin mutant (y65r) ph 4.6

PDB Compounds: (A:) Monellin chain B

SCOPe Domain Sequences for d5o7la1:

Sequence; same for both SEQRES and ATOM records:

>d5o7la1 d.17.1.1 (A:1-47) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiy

Timeline for d5o7la1:

• d5o7la1 is new in SCOPe 2.07-stable
  
• d5o7la1 does not appear in SCOPe 2.08