Lineage for d5nyla_ (5nyl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880169Species Populus tremula [TaxId:47664] [188794] (10 PDB entries)
  8. 2880174Domain d5nyla_: 5nyl A: [347080]
    automated match to d5vo7a_
    mutant

Details for d5nyla_

PDB Entry: 5nyl (more details), 1.5 Å

PDB Description: crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant
PDB Compounds: (A:) Thioredoxin-like protein 2.1

SCOPe Domain Sequences for d5nyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nyla_ c.47.1.0 (A:) automated matches {Populus tremula [TaxId: 47664]}
rptsvemepiddshhldkillqarelsqpiiidwmaswcgpciylkpkleklaaeydtki
kfycadvnkvpqalvkrgniskmptiqlwkdgemkaevigghkawlvieevremiqkfv

SCOPe Domain Coordinates for d5nyla_:

Click to download the PDB-style file with coordinates for d5nyla_.
(The format of our PDB-style files is described here.)

Timeline for d5nyla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nylb_