SCOPe 2.08: Domain d5o2ac2: 5o2a C:123-285

Lineage for d5o2ac2 (5o2a C:123-285)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346973] (3 PDB entries)

8. Domain d5o2ac2: 5o2a C:123-285 [347066]
   Other proteins in same PDB: d5o2aa1, d5o2ab1, d5o2ab3, d5o2ac1, d5o2ad1, d5o2ad3
   automated match to d1b0aa1

Details for d5o2ac2

PDB Entry: 5o2a, 1.9 Å

PDB Description: fold q98h

PDB Compounds: (C:) Bifunctional protein folD

SCOPe Domain Sequences for d5o2ac2:

Sequence; same for both SEQRES and ATOM records:

>d5o2ac2 c.2.1.7 (C:123-285) automated matches {Escherichia coli [TaxId: 83333]}
fhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmellla
gctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvvg
dvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdp

Timeline for d5o2ac2:

• d5o2ac2 first appeared in SCOPe 2.07