Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein automated matches [190465] (6 species) not a true protein |
Species Canis lupus [TaxId:9615] [347014] (1 PDB entry) |
Domain d5mzfb1: 5mzf B:1-156 [347015] Other proteins in same PDB: d5mzfb2 automated match to d1irya_ complexed with act, cl, gol, so4 |
PDB Entry: 5mzf (more details), 2 Å
SCOPe Domain Sequences for d5mzfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mzfb1 d.113.1.1 (B:1-156) automated matches {Canis lupus [TaxId: 9615]} mgtsrlytlvlvlqpervllgmkkrgfgagrwngfggkvqegetiedgakrelreesglt vdtlhkvgqimfefvgepelmdvhifctdsvqgtpvesdemrpqwfqldqipftdmwpdd sywfplllqkkkfhgyfrfqgpntildytlrevdkl
Timeline for d5mzfb1: