Lineage for d5n2km1 (5n2k M:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756777Domain d5n2km1: 5n2k M:2-112 [346984]
    Other proteins in same PDB: d5n2ka2, d5n2kc2, d5n2ke2, d5n2kg2, d5n2ki2, d5n2kk2, d5n2km2, d5n2ko2
    automated match to d1aqkl1
    complexed with edo

Details for d5n2km1

PDB Entry: 5n2k (more details), 2.22 Å

PDB Description: structure of unbound briakinumab fab
PDB Compounds: (M:) Briakinumab FAb light chain

SCOPe Domain Sequences for d5n2km1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2km1 b.1.1.0 (M:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtiscsgsrsnigsntvkwyqqlpgtapklliyyndqrpsgvpd
rfsgsksgtsaslaitglqaedeadyycqsydrythpallfgtgtkvtvlg

SCOPe Domain Coordinates for d5n2km1:

Click to download the PDB-style file with coordinates for d5n2km1.
(The format of our PDB-style files is described here.)

Timeline for d5n2km1: