Lineage for d5nxyc_ (5nxy C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915256Species Bacillus subtilis [TaxId:1423] [187940] (8 PDB entries)
  8. 2915258Domain d5nxyc_: 5nxy C: [346965]
    automated match to d3r6ua_
    complexed with 1y8, edo

Details for d5nxyc_

PDB Entry: 5nxy (more details), 1.9 Å

PDB Description: crystal structure of opuac from b. subtilis in complex with arsenobetaine
PDB Compounds: (C:) Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC

SCOPe Domain Sequences for d5nxyc_:

Sequence, based on SEQRES records: (download)

>d5nxyc_ c.94.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
qtikigaqsmseseiiasmqgqliehhtdlktttiknlgsnavqqqalmngeidiaatry
tgdaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhl
etvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkm
divlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidt
atmqelnyevdgnlkepsvvakeylekhryfe

Sequence, based on observed residues (ATOM records): (download)

>d5nxyc_ c.94.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
qtikigaqsmseseiiasmqgqliehhtdlktttiknlgqqalmngeidiaatrytgdal
tgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhletvsd
vkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkmdivla
ystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidtatmqe
lnyevdgnlkepsvvakeylekhryfe

SCOPe Domain Coordinates for d5nxyc_:

Click to download the PDB-style file with coordinates for d5nxyc_.
(The format of our PDB-style files is described here.)

Timeline for d5nxyc_: