Lineage for d5n9va1 (5n9v A:4-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 3046848Species Tetrahymena thermophila [TaxId:312017] [346910] (1 PDB entry)
  8. 3046849Domain d5n9va1: 5n9v A:4-81 [346911]
    Other proteins in same PDB: d5n9va2
    automated match to d2zcbb_

Details for d5n9va1

PDB Entry: 5n9v (more details)

PDB Description: nmr solution structure of ubl5 domain from polyubiquitin locus of t.thermophila.
PDB Compounds: (A:) NAD(P)(+)--arginine ADP-ribosyltransferase

SCOPe Domain Sequences for d5n9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n9va1 d.15.1.0 (A:4-81) automated matches {Tetrahymena thermophila [TaxId: 312017]}
qvsiefqngeklkfnvqpshkildikemifkktninvkdqslkfagneminqktlsdysi
idsteeftlhletkldlm

SCOPe Domain Coordinates for d5n9va1:

Click to download the PDB-style file with coordinates for d5n9va1.
(The format of our PDB-style files is described here.)

Timeline for d5n9va1:

  • d5n9va1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5n9va2