Lineage for d5n6va1 (5n6v A:5-554)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2417057Protein automated matches [190099] (29 species)
    not a true protein
  7. 2417159Species Neisseria polysaccharea [TaxId:489] [226280] (7 PDB entries)
  8. 3046826Domain d5n6va1: 5n6v A:5-554 [346888]
    Other proteins in same PDB: d5n6va2, d5n6va3
    automated match to d1g5aa2
    complexed with 1pe, epe, fru, glc, pge, suc, trs; mutant

Details for d5n6va1

PDB Entry: 5n6v (more details), 1.6 Å

PDB Description: crystal structure of neisseria polysaccharea amylosucrase mutant derived from neutral genetic drift-based engineering
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d5n6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n6va1 c.1.8.1 (A:5-554) automated matches {Neisseria polysaccharea [TaxId: 489]}
qylktrildiytpeqragieksedwrqfsrrmhthfpklmneldsvygnneallpmleml
laqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkipyfqe
lgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisavvdfi
fnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsqledgr
wvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtscenlpq
ahalirafnavmriaapavffkseaidhpdqvvqyigqdecqigynplqmallwntlatr
evnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnrffvn
rfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgglpli
ylgdevgtlndddwsqdsnksddsrwahrprynealyaqrnnpstaagqiyqdlrhmiav
rqsnprfdgg

SCOPe Domain Coordinates for d5n6va1:

Click to download the PDB-style file with coordinates for d5n6va1.
(The format of our PDB-style files is described here.)

Timeline for d5n6va1:

  • d5n6va1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06