Lineage for d5nfrm1 (5nfr M:1-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848010Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries)
  8. 2848030Domain d5nfrm1: 5nfr M:1-143 [346875]
    Other proteins in same PDB: d5nfra2, d5nfrb2, d5nfrc2, d5nfrd2, d5nfre2, d5nfrf2, d5nfrg2, d5nfrh2, d5nfri2, d5nfrj2, d5nfrk2, d5nfrl2, d5nfrm2, d5nfrn2, d5nfro2, d5nfrp2
    automated match to d3p7ma1
    complexed with cit

Details for d5nfrm1

PDB Entry: 5nfr (more details), 2.4 Å

PDB Description: crystal structure of malate dehydrogenase from plasmodium falciparum (pfmdh)
PDB Compounds: (M:) malate dehydrogenase

SCOPe Domain Sequences for d5nfrm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nfrm1 c.2.1.0 (M:1-143) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
ldimvnvfhkfsnlphekicgma

SCOPe Domain Coordinates for d5nfrm1:

Click to download the PDB-style file with coordinates for d5nfrm1.
(The format of our PDB-style files is described here.)

Timeline for d5nfrm1: