Lineage for d5nfrg2 (5nfr G:144-313)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 3046760Species Plasmodium falciparum [TaxId:36329] [346822] (1 PDB entry)
  8. 3046793Domain d5nfrg2: 5nfr G:144-313 [346855]
    Other proteins in same PDB: d5nfra1, d5nfrb1, d5nfrc1, d5nfrd1, d5nfre1, d5nfrf1, d5nfrg1, d5nfrh1, d5nfri1, d5nfrj1, d5nfrk1, d5nfrl1, d5nfrm1, d5nfrn1, d5nfro1, d5nfrp1
    automated match to d3p7ma2
    complexed with cit

Details for d5nfrg2

PDB Entry: 5nfr (more details), 2.4 Å

PDB Description: crystal structure of malate dehydrogenase from plasmodium falciparum (pfmdh)
PDB Compounds: (G:) malate dehydrogenase

SCOPe Domain Sequences for d5nfrg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nfrg2 d.162.1.0 (G:144-313) automated matches {Plasmodium falciparum [TaxId: 36329]}
gildtsrycsliadklkvsaedvnavilgghgdlmvplqrytsvngvplsefvkknmisq
neiqeiiqktrnmgaeiiklakasaafapaaaitkmiksylynennlftcavylnghync
snlfvgstakinnkgahpvefpltkeeqdlytesiasvqsntqkafdlik

SCOPe Domain Coordinates for d5nfrg2:

Click to download the PDB-style file with coordinates for d5nfrg2.
(The format of our PDB-style files is described here.)

Timeline for d5nfrg2:

  • d5nfrg2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06