Lineage for d5mqzf_ (5mqz F:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 3046480Species Archaeoglobus fulgidus [TaxId:224325] [346542] (2 PDB entries)
  8. 3046771Domain d5mqzf_: 5mqz F: [346833]
    automated match to d5cm0b_
    complexed with cl, edo, peg, tam

Details for d5mqzf_

PDB Entry: 5mqz (more details), 2.1 Å

PDB Description: archaeal branched-chain amino acid aminotransferase from archaeoglobus fulgidus; holoform
PDB Compounds: (F:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d5mqzf_:

Sequence, based on SEQRES records: (download)

>d5mqzf_ e.17.1.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgk
lygdlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngy
vsegsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytade
vfvtgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye

Sequence, based on observed residues (ATOM records): (download)

>d5mqzf_ e.17.1.0 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
mlyvymdgefvpeneakvsifdhgflygdgvfegirayngrvfrlkehidrlydsakaid
leipitkeefmeiiletlrknnlrdayirpivtrgigdlgldprkcqnpsiivitkpwgg
dlyekgltaitvavrrnsfdalppnikslnylnnilakieanakggdeaifldrngyvse
gsgdnifvvkngaittpptinnlrgitreavieiinrlgipfketniglydlytadevfv
tgtaaeiapivvidgrkigdgkpgeitrklmeefskltesegvpiye

SCOPe Domain Coordinates for d5mqzf_:

Click to download the PDB-style file with coordinates for d5mqzf_.
(The format of our PDB-style files is described here.)

Timeline for d5mqzf_:

  • d5mqzf_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-05