Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Haliangium ochraceum [TaxId:80816] [346709] (1 PDB entry) |
Domain d5n5fh_: 5n5f H: [346782] automated match to d1zpyg_ complexed with na |
PDB Entry: 5n5f (more details), 2.06 Å
SCOPe Domain Sequences for d5n5fh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n5fh_ a.25.1.0 (H:) automated matches {Haliangium ochraceum [TaxId: 80816]} qlhepaellseetknmhralvtlieeleavdwyqqradacsepglhdvlihnkneeveha mmtlewirrrspvfdahmrtylfterpilel
Timeline for d5n5fh_: