Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [346571] (3 PDB entries) |
Domain d5mzgb_: 5mzg B: [346779] Other proteins in same PDB: d5mzga2 automated match to d5ws7a_ complexed with 2ge, scn, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5mzg (more details), 1.85 Å
SCOPe Domain Sequences for d5mzgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mzgb_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Mouse (Mus musculus) [TaxId: 10090]} mstsrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgakrelleesgls vdtlhkvghisfefvgspelmdvhifsadhvhgtpteseemrpqwfqldqipfadlwpdd sywfplllqkkkfcghfkfqdqdtilsyslrev
Timeline for d5mzgb_: