Lineage for d5mdls_ (5mdl S:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019205Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 3019206Protein automated matches [191172] (11 species)
    not a true protein
  7. 3019280Species Ralstonia eutropha [TaxId:381666] [256057] (8 PDB entries)
  8. 3019282Domain d5mdls_: 5mdl S: [346761]
    Other proteins in same PDB: d5mdll_
    automated match to d3rgws_
    complexed with cl, f3s, f4s, mg, nfv, o, oxy, peg, sf4

Details for d5mdls_

PDB Entry: 5mdl (more details), 1.41 Å

PDB Description: crystal structure of an o2-tolerant [nife]-hydrogenase from ralstonia eutropha in its o2-derivatized form by a "soak-and-freeze" derivatization method
PDB Compounds: (S:) Uptake hydrogenase small subunit;HOXK

SCOPe Domain Sequences for d5mdls_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mdls_ e.19.1.0 (S:) automated matches {Ralstonia eutropha [TaxId: 381666]}
prtpvlwlhglectccsesfirsahplakdvvlsmisldyddtlmaaaghqaeaileeim
tkykgnyilavegnpplnqdgmsciiggrpfieqlkyvakdakaiiswgscaswgcvqaa
kpnptqatpvhkvitdkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmfysq
rihdkcyrrphfdagqfveewddesarkgfclykmgckgpttynacsttrwnegtsfpiq
sghgcigcsedgfwdkgsfydrltgisqf

SCOPe Domain Coordinates for d5mdls_:

Click to download the PDB-style file with coordinates for d5mdls_.
(The format of our PDB-style files is described here.)

Timeline for d5mdls_: