SCOPe 2.08: Domain d5bk1l2: 5bk1 L:109-216

Lineage for d5bk1l2 (5bk1 L:109-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5bk1l2: 5bk1 L:109-216 [346736]
   Other proteins in same PDB: d5bk1a_, d5bk1b_, d5bk1c_, d5bk1d1, d5bk1h_, d5bk1l1
   automated match to d1dn0a2
   complexed with cl, gol

Details for d5bk1l2

PDB Entry: 5bk1, 2.15 Å

PDB Description: crystal structure of maltose binding protein in complex with an endosteric synthetic antibody

PDB Compounds: (L:) Synthetic antibody, Fab fragment, Light Chain

SCOPe Domain Sequences for d5bk1l2:

Sequence; same for both SEQRES and ATOM records:

>d5bk1l2 b.1.1.2 (L:109-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwsvdnalqsgnsqesvteq
dskdstyslsstltlssadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5bk1l2:

• d5bk1l2 first appeared in SCOPe 2.07