Lineage for d5n0ga_ (5n0g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2859540Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
    automatically mapped to Pfam PF02570
  5. 2859541Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 2859555Protein automated matches [190963] (2 species)
    not a true protein
  7. 2859561Species Rhodobacter capsulatus [TaxId:272942] [194508] (3 PDB entries)
  8. 2859564Domain d5n0ga_: 5n0g A: [346721]
    automated match to d4au1a_
    complexed with 8f5, gol

Details for d5n0ga_

PDB Entry: 5n0g (more details), 1.57 Å

PDB Description: crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba
PDB Compounds: (A:) precorrin-8x methylmutase

SCOPe Domain Sequences for d5n0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n0ga_ c.23.17.1 (A:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
pheyekdgakiyvqsfatiraeadlarftpeeevvvvrmihaagmvglenhvrfapgmai
aaraaleagapilcdarmvsegiararlpaknevictlqdprvpalaqemgntrsaaale
lwrpklegavvaignaptalfhllnmledpacprpaaiigcpvgfigaaeskaalavanp
vpwvivegrlggsaitvaavnalacrke

SCOPe Domain Coordinates for d5n0ga_:

Click to download the PDB-style file with coordinates for d5n0ga_.
(The format of our PDB-style files is described here.)

Timeline for d5n0ga_: