Lineage for d5mrrc_ (5mrr C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798459Species Lysobacter sp. [TaxId:186334] [346506] (3 PDB entries)
  8. 2798462Domain d5mrrc_: 5mrr C: [346697]
    automated match to d2ea3a_
    complexed with cl, gol, na, so4, trs

Details for d5mrrc_

PDB Entry: 5mrr (more details), 1.35 Å

PDB Description: crystal structure of l1 protease of lysobacter sp. xl1
PDB Compounds: (C:) Lytic endopeptidase preproenzyme

SCOPe Domain Sequences for d5mrrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrrc_ b.47.1.0 (C:) automated matches {Lysobacter sp. [TaxId: 186334]}
vnvlggieysinnatlcsvgfsvtrgatkgfvtaghcggvgaivriggtqvgsfaarvfp
gndrawvsvgsahtlqgavsnysggtiairgsaeaaigaavcrsgrttgyrcgnitaknv
tanyaegavrgltqgnacmgrgdsggswftsagqaqgvmsggnvqsngnncgipasqrss
lfervgpilsqyglslvts

SCOPe Domain Coordinates for d5mrrc_:

Click to download the PDB-style file with coordinates for d5mrrc_.
(The format of our PDB-style files is described here.)

Timeline for d5mrrc_: