SCOPe 2.07: Domain d5mpna1: 5mpn A:1081-1196

Lineage for d5mpna1 (5mpn A:1081-1196)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)

8. Domain d5mpna1: 5mpn A:1081-1196 [346660]
   Other proteins in same PDB: d5mpna2
   automated match to d4nyxa_
   complexed with edo, ye5

Details for d5mpna1

PDB Entry: 5mpn, 1.23 Å

PDB Description: crystal structure of crebbp bromodomain complexed with fa26

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5mpna1:

Sequence; same for both SEQRES and ATOM records:

>d5mpna1 a.29.2.1 (A:1081-1196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d5mpna1:

• d5mpna1 is new in SCOPe 2.07-stable
  
• d5mpna1 appears in the current release, SCOPe 2.08